PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA02g27910
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family WRKY
Protein Properties Length: 500aa    MW: 55037.6 Da    PI: 7.6992
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA02g27910genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY93.81.3e-29228283359
                 -SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
        WRKY   3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                 DgynWrKYGqK+vk +e+prsYY+Ct+ +Cp+kkkve+s  d++++eitY+g+Hnh 
  CA02g27910 228 DGYNWRKYGQKKVKATECPRSYYKCTHLKCPAKKKVEKSV-DGHITEITYNGRHNHA 283
                 9***************************************.***************7 PP

2WRKY105.62.5e-33422480159
                 ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
        WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                 ldDgy+WrKYGqK vkg+++prsYYrCt+agC+v+k+ver+++dpk+v++tYeg+Hnh+
  CA02g27910 422 LDDGYRWRKYGQKAVKGTQHPRSYYRCTYAGCNVRKQVERASTDPKAVITTYEGKHNHD 480
                 59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007748.6E-32226284IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.7E-25226285IPR003657WRKY domain
SuperFamilySSF1182903.27E-22227285IPR003657WRKY domain
PROSITE profilePS5081121.505228285IPR003657WRKY domain
PfamPF031062.5E-22228282IPR003657WRKY domain
Gene3DG3DSA:2.20.25.804.4E-36408482IPR003657WRKY domain
SuperFamilySSF1182901.57E-29414482IPR003657WRKY domain
PROSITE profilePS5081136.07417482IPR003657WRKY domain
SMARTSM007744.1E-39422481IPR003657WRKY domain
PfamPF031061.3E-26423480IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 500 aa     Download sequence    Send to blast
MGETGGEASA ISFPALTIPP RPSYESFFNM SSFSPGPMSL VSSFLSEQSP DSADRPSFSQ  60
LLAGVIASPT LLPDDSGDPS GSEKSTGYRK NRPMNLALAQ SPLFMIPSGF SPSGFLNSPG  120
FLSPLQSPFG MSHQQALAHV TAQAECSSSY MQMQAEDQCS AQVASAEAAL GNELLTDPKE  180
SSLQIKECLQ PRLDKKPSDK QGKQFELTEV PQFENKTSFG AFDKSACDGY NWRKYGQKKV  240
KATECPRSYY KCTHLKCPAK KKVEKSVDGH ITEITYNGRH NHAQPTKQRK DGSALDSTDG  300
SGVQPDISTH DWTVMNSSDG SSPSHSEQVP NQMASELVKK ECDETKSNLI EVDEGHDEPD  360
AKRTMSHPSV VKQEEKLYSN KSMYLIQLLC CRKMAVETLA SSHGTVAESK IILQTRSEVD  420
ILDDGYRWRK YGQKAVKGTQ HPRSYYRCTY AGCNVRKQVE RASTDPKAVI TTYEGKHNHD  480
IPTVIRNRGT RNTAKDTWR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A1e-34228482877Probable WRKY transcription factor 4
1wj2_A1e-34228482877Probable WRKY transcription factor 4
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY7405310.0AY740531.1 Capsicum annuum WRKY transcription factor-c (WRKY-c) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016561364.10.0PREDICTED: probable WRKY transcription factor 3
TrEMBLQ5DJV30.0Q5DJV3_CAPAN; WRKY transcription factor-c
STRINGPGSC0003DMT4000036370.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA43142344
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13960.11e-107WRKY DNA-binding protein 4